SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83977452|ref|NP_054700.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83977452|ref|NP_054700.2|
Domain Number 1 Region: 603-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-71
Family Protein kinases, catalytic subunit 0.00000133
Further Details:      
 
Domain Number 2 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.88e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83977452|ref|NP_054700.2|
Sequence length 919
Comment epithelial discoidin domain-containing receptor 1 isoform 3 precursor [Homo sapiens]
Sequence
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNASFSLFSRNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLS
AHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLV
GENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLW
EVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQ
RPPFSQLHRFLAEDALNTV
Download sequence
Identical sequences A0A024RCJ0 A0A2J8NXE9
ENSP00000379631 ENSP00000406089 ENSP00000407068 ENSP00000416145 ENSP00000416183 NP_054700.2.87134 NP_054700.2.92137 XP_011513185.1.92137 XP_011513186.1.92137 XP_011513187.1.92137 XP_011513188.1.92137 XP_011513189.1.92137 XP_016866757.1.92137 ENSP00000365759 ENSP00000427552 ENSP00000448377 ENSP00000449190 ENSP00000449255 ENSP00000449611 9606.ENSP00000393085 9606.ENSP00000397716 9606.ENSP00000406091 9606.ENSP00000409630 gi|83977452|ref|NP_054700.2| ENSP00000427552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]