SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|84798622|ref|NP_005899.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84798622|ref|NP_005899.3|
Domain Number 1 Region: 323-690
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.84e-106
Family beta-glycanases 0.000000582
Further Details:      
 
Domain Number 2 Region: 21-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-51
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00033
Further Details:      
 
Domain Number 3 Region: 214-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000379
Family beta-Galactosidase/glucuronidase domain 0.0056
Further Details:      
 
Domain Number 4 Region: 696-795
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000331
Family beta-Galactosidase/glucuronidase domain 0.016
Further Details:      
 
Domain Number 5 Region: 801-879
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000187
Family beta-Galactosidase/glucuronidase domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84798622|ref|NP_005899.3|
Sequence length 879
Comment beta-mannosidase precursor [Homo sapiens]
Sequence
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQD
SYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETD
NMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNF
VRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFD
VVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNITVETWWPHGHGNQTG
YNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPA
DSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACA
LYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKD
YVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDC
WNWKVFPKARFASEYGYQSWPSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAG
LHFKLPQSTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQGHTMGALYWQLN
DIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMTLSV
RVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHE
LLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFS
DNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTSLTDIY
Download sequence
Identical sequences O00462
NYSGRC-84798622 ENSP00000226578 9606.ENSP00000226578 ENSP00000422001 NP_005899.3.87134 NP_005899.3.92137 gi|84798622|ref|NP_005899.3| ENSP00000226578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]