SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85068512|ref|NP_599151.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85068512|ref|NP_599151.2|
Domain Number 1 Region: 136-206
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.4e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0000215
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.33e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.00039
Further Details:      
 
Domain Number 3 Region: 272-339
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000314
Family Double-stranded RNA-binding domain (dsRBD) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85068512|ref|NP_599151.2|
Sequence length 345
Comment RISC-loading complex subunit TARBP2 isoform b [Homo sapiens]
Sequence
MLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTGQGPSKK
AAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLTR
SPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERF
IEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGP
GCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLSG
LCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMAGSK
Download sequence
Identical sequences A0A2J8KCW3 A0A2J8SX25
gi|19743838|ref|NP_004169.3| gi|85068512|ref|NP_599151.2| ENSP00000377885 ENSP00000416077 ENSP00000377885 ENSP00000416077 NP_004169.3.87134 NP_004169.3.92137 NP_599151.2.87134 NP_599151.2.92137 XP_003313704.1.37143 XP_004053285.1.27298 XP_005269171.1.92137 XP_005269172.1.92137 XP_008954647.1.60992 XP_008954648.1.60992 XP_008954649.1.60992 XP_009423543.1.37143 XP_009423544.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]