SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8922188|ref|NP_060908.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8922188|ref|NP_060908.1|
Domain Number 1 Region: 75-258
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.53e-75
Family F-box associated region, FBA 0.00000164
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily F-box domain 7.19e-17
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8922188|ref|NP_060908.1|
Sequence length 293
Comment F-box only protein 6 [Homo sapiens]
Sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Download sequence
Identical sequences Q9NRD1
9606.ENSP00000365944 NP_060908.1.87134 NP_060908.1.92137 XP_003822127.1.60992 XP_005263505.1.92137 XP_005263506.1.92137 XP_005263508.1.92137 XP_006710634.1.92137 XP_008973855.1.60992 XP_008973856.1.60992 XP_008973858.1.60992 XP_008973859.1.60992 XP_011539534.1.92137 XP_016856496.1.92137 ENSP00000365944 ENSP00000365944 ENSP00000365944 gi|8922188|ref|NP_060908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]