SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923179|ref|NP_060173.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923179|ref|NP_060173.1|
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily RNI-like 1.33e-18
Family Cyclin A/CDK2-associated p19, Skp2 0.078
Further Details:      
 
Domain Number 2 Region: 6-39
Classification Level Classification E-value
Superfamily F-box domain 0.0000000183
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8923179|ref|NP_060173.1|
Sequence length 326
Comment F-box/LRR-repeat protein 12 [Homo sapiens]
Sequence
MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMW
HLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPIT
SLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRS
LVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGL
SAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAE
KILCKGLPHCMVIVRACPKESMDWWM
Download sequence
Identical sequences A0A0D9R5M7 A0A2I3HIX4 A0A2K6E2Y5 H2QFA2 Q9NXK8
ENSNLEP00000014566 ENSP00000247977 9598.ENSPTRP00000017776 9606.ENSP00000247977 ENSP00000247977 gi|8923179|ref|NP_060173.1| ENSP00000247977 ENSNLEP00000014566 ENSPTRP00000017776 ENSPTRP00000017776 NP_060173.1.87134 NP_060173.1.92137 XP_003809654.1.60992 XP_004089367.1.23891 XP_007993384.1.81039 XP_009432924.1.37143 XP_011734719.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]