SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923374|ref|NP_060273.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923374|ref|NP_060273.1|
Domain Number 1 Region: 12-304
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.2e-66
Family FMN-linked oxidoreductases 0.00066
Further Details:      
 
Domain Number 2 Region: 347-462
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.32e-32
Family Double-stranded RNA-binding domain (dsRBD) 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8923374|ref|NP_060273.1|
Sequence length 493
Comment tRNA-dihydrouridine synthase 2-like [Homo sapiens]
Sequence
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVL
STVDFVAPDDRVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQY
STKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAI
AVHGRKREERPQHPVSCEVIKAIADTLSIPVIANGGSHDHIQQYSDIEDFRQATAASSVM
VARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTNTKYCLCQMLREQLESPQGRL
LHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTSGVIKMAVKFD
RRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFV
ALGSGEESPLEGW
Download sequence
Identical sequences A0A024R6Z7 Q9NX74
9606.ENSP00000351769 gi|8923374|ref|NP_060273.1| ENSP00000351769 ENSP00000455229 NP_001258691.1.87134 NP_001258691.1.92137 NP_060273.1.87134 NP_060273.1.92137 ENSP00000351769 ENSP00000455229 ENSP00000351769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]