SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923380|ref|NP_060277.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923380|ref|NP_060277.1|
Domain Number 1 Region: 4-306
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.53e-32
Family YeaZ-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8923380|ref|NP_060277.1|
Sequence length 335
Comment probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP [Homo sapiens]
Sequence
MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHRAVILDLLQEA
LTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLWNKPLVGVNHCIGHIEMGRLI
TGATSPTVLYVSGGNTQVIAYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNI
EQMAKRGKKLVELPYTVKGMDVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAM
LVEITERAMAHCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIA
QAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD
Download sequence
Identical sequences H2Q7W2 Q9NPF4
gi|8923380|ref|NP_060277.1| NP_060277.1.87134 NP_060277.1.92137 XP_001139005.1.37143 XP_003811775.1.60992 ENSP00000206542 9598.ENSPTRP00000010343 9606.ENSP00000206542 ENSP00000206542 ENSP00000206542 ENSPTRP00000010343 ENSPTRP00000010343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]