SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923516|ref|NP_060343.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923516|ref|NP_060343.1|
Domain Number 1 Region: 48-298
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.11e-31
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 365-413
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000811
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8923516|ref|NP_060343.1|
Sequence length 421
Comment ankyrin repeat and SOCS box protein 6 isoform 1 [Homo sapiens]
Sequence
MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKA
HSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVE
LLVHHGADVNRRDRIHESSPLDLASEEPERLPCLQRLLDLGADVNAADKHGKTALLHALA
SSDGVQIHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVGGDKEEAQMINRFCF
QVTRLLLAHGADPSECPAHESLTHICLKSFKLHFPLLRFLLESGAAYNCSLHGASCWSGF
HIIFERLCSHPGCTEDESHADLLRKAETVLDLMVTNSQKLQLPENFDIHPVGSLAEKIQA
LHFSLRQLESYPPPLKHLCRVAIRLYLQPWPVDVKVKALPLPDRLKWYLLSEHSGSVEDD
I
Download sequence
Identical sequences H2QY09 Q9NWX5
gi|8923516|ref|NP_060343.1| ENSP00000277458 NP_060343.1.87134 NP_060343.1.92137 XP_001163675.1.37143 9598.ENSPTRP00000036709 9606.ENSP00000277458 ENSP00000277458 ENSP00000277458 ENSPTRP00000036709 ENSPTRP00000036709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]