SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923708|ref|NP_060017.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923708|ref|NP_060017.1|
Domain Number 1 Region: 64-308,416-479
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-41
Family FAD-linked reductases, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8923708|ref|NP_060017.1|
Sequence length 486
Comment FAD-dependent oxidoreductase domain-containing protein 1 [Homo sapiens]
Sequence
MIRRVLPHGMGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGRSCDLLQDTSHLP
PEHSDVVIVGGGVLGLSVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFS
LPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQ
EGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQ
GEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAA
LAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYL
GGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKI
QENNII
Download sequence
Identical sequences Q96CU9
ENSP00000263578 HR6756 NYSGRC-8923708 NP_060017.1.87134 NP_060017.1.92137 ENSP00000263578 gi|8923708|ref|NP_060017.1| ENSP00000263578 9606.ENSP00000263578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]