SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923763|ref|NP_060874.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923763|ref|NP_060874.1|
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 251-360
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-20
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 3 Region: 135-231
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-18
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8923763|ref|NP_060874.1|
Sequence length 381
Comment arf-GAP with dual PH domain-containing protein 2 [Homo sapiens]
Sequence
MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISR
VKSVRLDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERR
EFMADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISI
KDLNATFQTEKIGHPHGLQITYRRDGHTRNLFVYHESGKEIVDWFNALRAARLQYLKMAF
PELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQG
QVFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQEWLESLRGVL
SSPLTPLNRLTASTESGRSSR
Download sequence
Identical sequences Q9NPF8
ENSP00000329468 ENSP00000329468 gi|8923763|ref|NP_060874.1| 9606.ENSP00000329468 NP_060874.1.87134 NP_060874.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]