SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|8923842|ref|NP_060886.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923842|ref|NP_060886.1|
Domain Number 1 Region: 66-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-36
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|8923842|ref|NP_060886.1|
Sequence length 574
Comment forkhead box protein J2 [Homo sapiens]
Sequence
MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAA
VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGS
GEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFK
FSYSEINFQDLSWSFRNLYKSMLEKSSSSSQHGFSSLLGDIPPSNNYYMYQQQQPPPPQQ
QQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCTPPGGKQAGAEGYGPP
PVMAMHPPPLQHGGYHPHQHHPHSHPAQQPPPPQPQAQGQAPINNTGFAFPSDWCSNIDS
LKESFKMVNRLNWSSIEQSQFSELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQTGHV
PPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSA
GYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT
Download sequence
Identical sequences Q9P0K8
hsk003001275.1 hsk003001275.2 NP_060886.1.87134 NP_060886.1.92137 ENSP00000162391 gi|8923842|ref|NP_060886.1| 9606.ENSP00000162391 ENSP00000162391 ENSP00000162391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]