SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89941470|ref|NP_001034977.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89941470|ref|NP_001034977.1|
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-26
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89941470|ref|NP_001034977.1|
Sequence length 496
Comment ankyrin repeat domain-containing protein 34A [Homo sapiens]
Sequence
MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMV
RYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHAGASALVHALD
RGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGF
CTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPPRHPPK
PLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTLTGRPRLSRRHSTEGPEDPPP
WAEKVTSGGPLSRRNTAPEAQESGPPSGLRQKLSRMEPVELDTPGHLCPDSPESSRLSLE
RRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQT
RPGFLPPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIR
LLGGFQSLGGPGEPGR
Download sequence
Identical sequences Q69YU3
ENSP00000475189 gi|89941470|ref|NP_001034977.1| 9606.ENSP00000314103 ENSP00000314103 ENSP00000475189 NP_001034977.1.87134 NP_001034977.1.92137 ENSP00000314103 ENSP00000464502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]