SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|91984781|ref|NP_006067.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91984781|ref|NP_006067.3|
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91984781|ref|NP_006067.3|
Sequence length 481
Comment arf-GAP domain and FG repeats-containing protein 2 [Homo sapiens]
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPVQGSIPEGKPLRTLLG
DPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMA
PAFAAFPAFGGQTPSQGGFANFDAFSSGPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPF
GATPLAPASQPNSLADVGSFLGPGVPAAGVPSSLFGMAGQVPPLQSVTMGGGGGSSTGLA
FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAP
LFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTNPF
L
Download sequence
Identical sequences A4D2D6 O95081
ENSP00000300176 NP_006067.3.87134 NP_006067.3.92137 9606.ENSP00000300176 ENSP00000300176 gi|91984781|ref|NP_006067.3| ENSP00000300176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]