SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|92087060|ref|NP_563616.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|92087060|ref|NP_563616.3|
Domain Number 1 Region: 47-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.57e-65
Family Ankyrin repeat 0.0000177
Further Details:      
 
Domain Number 2 Region: 524-579
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000131
Family SOCS box-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|92087060|ref|NP_563616.3|
Sequence length 588
Comment ankyrin repeat and SOCS box protein 15 [Homo sapiens]
Sequence
MDTNDDPDEDHLTSYDIQLSIQESIEASKTALCPERFVPLSAQNRKLVEAIKQGHIPELQ
EYVKYKYAMDEADEKGWFPLHEAVVQPIQQILEIVLDASYKTLWEFKTCDGETPLTLAVK
AGLVENVRTLLEKGVWPNTKNDKGETPLLIAVKKGSYDMVSTLIKHNTSLDQPCVKRWSA
MHEAAKQGRKDIVALLLKHGGNVHLRDGFGVTPLGVAAEYGHCDVLEHLIHKGGDVLALA
DDGASVLFEAAGGGNPDCISLLLEYGGSGNVPNRAGHLPIHRAAYEGHYLALKYLIPVTS
KNAIRKSGLTPIHSAADGQNAQCLELLIENGFDVNTLLADHISQSYDDERKTALYFGVSN
NDVHCTEVLLAAGADPNLDPLNCLLVAVRANNYEIVRLLLSHGANVNCYFMHVNDTRFPS
VIQYALNDEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSEIQEEVLPGWTSCVIKDNP
FCEFITVPWMKHLVGRVTRVLIDYMDYVPLCAKLKSALEVQREWPEIRQILENPCSLKHL
CRLKIRRLMGLQKLCQPASVEKLPLPPAIQRYILFKEYDLYGQELKLT
Download sequence
Identical sequences Q8WXK1
gi|92087060|ref|NP_563616.3| NP_001277187.1.87134 NP_001277187.1.92137 NP_563616.3.87134 NP_563616.3.92137 XP_005250203.1.92137 XP_011514119.1.92137 XP_011514120.1.92137 XP_011514121.1.92137 XP_011514122.1.92137 XP_016867245.1.92137 XP_016867246.1.92137 ENSP00000275699 ENSP00000275699 ENSP00000390963 ENSP00000397655 ENSP00000416433 ENSP00000438643 ENSP00000275699 ENSP00000390963 ENSP00000397655 ENSP00000416433 HR6083 9606.ENSP00000275699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]