SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|92373393|ref|NP_001035225.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|92373393|ref|NP_001035225.1|
Domain Number 1 Region: 162-344
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.1e-52
Family Actin/HSP70 0.000000045
Further Details:      
 
Domain Number 2 Region: 4-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.38e-50
Family Actin/HSP70 0.000000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|92373393|ref|NP_001035225.1|
Sequence length 348
Comment actin-related protein 3B isoform 2 [Homo sapiens]
Sequence
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
Download sequence
Identical sequences A0A2I3LY42 A0A2I3TUJ9 A0A2K5JU65 A0A2K5NYS4 A0A2K5PKI6 A0A2K5WHR8 A0A2K6C566 A0A2K6RSM9 F6ZTX4
gi|92373393|ref|NP_001035225.1| ENSP00000367007 ENSP00000367007 NP_001035225.1.87134 NP_001035225.1.92137 XP_001144109.1.37143 XP_011796915.1.43180 ENSMMUP00000024893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]