SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|93102379|ref|NP_061027.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|93102379|ref|NP_061027.2|
Domain Number 1 Region: 1260-1525
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-51
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 530-792
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-47
Family YWTD domain 0.00000529
Further Details:      
 
Domain Number 3 Region: 1880-2125
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-47
Family YWTD domain 0.0000164
Further Details:      
 
Domain Number 4 Region: 1575-1832
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-43
Family YWTD domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 205-463
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-42
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 6 Region: 3015-3270
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-42
Family YWTD domain 0.0000206
Further Details:      
 
Domain Number 7 Region: 2189-2456
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3891-4169
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-31
Family YWTD domain 0.0000523
Further Details:      
 
Domain Number 9 Region: 2921-3007,3263-3324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1163-1252,1526-1570
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000051
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 3757-3797
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 877-922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 13 Region: 3631-3667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 14 Region: 842-878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 15 Region: 920-960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 2759-2795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 2890-2931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 3552-3587
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 19 Region: 3352-3392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 965-1003
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3673-3718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 22 Region: 3474-3510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 23 Region: 1005-1043
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 24 Region: 2680-2716
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3314-3349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 2545-2586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 27 Region: 3592-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 2801-2837
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 1052-1088
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 30 Region: 3509-3549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 31 Region: 2586-2625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 32 Region: 3435-3471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3394-3431
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 34 Region: 1834-1884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.014
Further Details:      
 
Domain Number 35 Region: 2719-2761
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 36 Region: 31-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 37 Region: 2510-2547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 2839-2879
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 39 Region: 2639-2675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 148-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 41 Region: 76-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 42 Region: 1098-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 43 Region: 1134-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 44 Region: 2144-2193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000245
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 45 Region: 108-195,461-516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 46 Region: 4288-4323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000402
Family EGF-type module 0.027
Further Details:      
 
Domain Number 47 Region: 4394-4428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000914
Family EGF-type module 0.047
Further Details:      
 
Domain Number 48 Region: 3805-3851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.032
Further Details:      
 
Domain Number 49 Region: 3844-3880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 50 Region: 798-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.02
Further Details:      
 
Domain Number 51 Region: 3719-3751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|93102379|ref|NP_061027.2|
Domain Number - Region: 4252-4287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4215-4251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000409
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4325-4357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0389
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|93102379|ref|NP_061027.2|
Sequence length 4599
Comment low-density lipoprotein receptor-related protein 1B precursor [Homo sapiens]
Sequence
MSEFLLALLTLSGLLPIARVLTVGADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPD
DSDESLDTCPEEVEIKCPLNHIACLGTNKCVHLSQLCNGVLDCPDGYDEGVHCQELLSNC
QQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSC
VEGYLMQPDNRSCKAKIEPTDRPPILLIANFETIEVFYLNGSKMATLSSVNGNEIHTLDF
IYNEDMICWIESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLTRNLYFV
DHVGDRIFVCNSNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHTVIQGRQVRHLYGIT
VFEDYLYATNSDNYNIVRINRFNGTDIHSLIKIENAWGIRIYQKRTQPTVRSHACEVDPY
GMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDL
NTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDDLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPVNGWMY
WTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIE
KVFLNGTHRKIVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLLRHERPP
LFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEA
LPHICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQNNRCIP
KRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMA
SCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFRCSSGRCIP
GHWACDGDNDCGDFSDEAQINCTKEEIHSPAGCNGNEFQCHPDGNCVPDLWRCDGEKDCE
DGSDEKGCNGTIRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSFLCGPPK
HPCANDTSVCLQPEKLCNGKKDCPDGSDEGYLCDECSLNNGGCSNHCSVVPGRGIVCSCP
EGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDPFEA
FIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSES
GGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHP
RAIALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDHFEKRIV
WTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTG
QNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPHLM
KLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERL
YWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARL
DGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSI
DYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQL
GTCSKRDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSETTRTCM
CTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAE
NDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAVDWIAGNIYWTDHGFNLIEVA
RLNGSFRYVIISQGLDQPRSIAVHPEKGLLFWTEWGQMPCIGKARLDGSEKVVLVSMGIA
WPNGISIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGAYIYWSD
RAHANGSVRRGHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCARDNGGCKQLCLY
RGNSRRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPRY
FKNVIALAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHRAW
DTLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFWTNWNEQ
HPSIMRSTLTGKNAQVVVSTDILTPNGLTIDYRAEKLYFSDGSLGKIERCEYDGSQRHVI
VKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDT
NSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLEDNRCVTKNSSCNAYSEFECGN
GECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGENDCGDN
SDELDCKVSTCATVEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFYKLGVKT
TGFIRCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFSCPSGRCILNTWI
CDGQKDCEDGRDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDSICGAIT
CAADMFSCQGSRACVPRHWLCDGERDCPDGSDELSTAGCAPNNTCDENAFMCHNKVCIPK
QFVCDHDDDCGDGSDESPQCGYRQCGTEEFSCADGRCLLNTQWQCDGDFDCPDHSDEAPL
NPKCKSAEQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINECLSKKVSGCSQ
DCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCLCTDGYEIQ
PDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWI
DSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLY
PTILVSKRLKFPRDLSLDPQAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALT
IDYVNRRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRA
HKTSGADRLSLIYSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPGKTHTCAC
PTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFRCQPG
RFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQD
DCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHE
FQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDFDC
ADGSDERNCETSCSKDQFRCSNGQCIPAKWKCDGHEDCKYGEDEKSCEPASPTCSSREYI
CASDGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGIHDCVD
GSDEENCERGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFLCPSTRP
HRCRNNRICLQSEQMCNGIDECGDNSDEDHCGGKLTYKARPCKKDEFACSNKKCIPMDLQ
CDRLDDCGDGSDEQGCRIAPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMKNR
QCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNNTCIAEGSEDQVLYIANDTDILG
FIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQAN
SGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTR
LLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAVDY
FSERIYWADFELSIIGSVLYDGSNSVVSVSSKQGLLHPHRIDIFEDYIYGAGPKNGVFRV
QKFGHGSVEYLALNIDKTKGVLISHRYKQLDLPNPCLDLACEFLCLLNPSGATCVCPEGK
YLINGTCNDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCEVNHCSNYCQNG
GTCVPSVLGRPTCSCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQPEYTGDRC
QYYVCHHYCVNSESCTIGDDGSVECVCPTRYEGPKCEVDKCVRCHGGHCIINKDSEDIFC
NCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSKSDHIS
TRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEV
DHDHNDGGLLDPGFMIDPTKARYIGGGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNP
VYAKLYMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences Q9NZR2
ENSP00000374135 ENSP00000374135 ENSP00000374135 gi|93102379|ref|NP_061027.2| 9606.ENSP00000374135 NP_061027.2.87134 NP_061027.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]