SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|93204871|ref|NP_067052.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|93204871|ref|NP_067052.2|
Domain Number 1 Region: 502-628
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-28
Family Netrin-like domain (NTR/C345C module) 0.084
Further Details:      
 
Domain Number 2 Region: 332-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000148
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 395-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 262-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family Laminin-type module 0.055
Further Details:      
 
Weak hits

Sequence:  gi|93204871|ref|NP_067052.2|
Domain Number - Region: 96-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0272
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|93204871|ref|NP_067052.2|
Sequence length 628
Comment netrin-4 precursor [Homo sapiens]
Sequence
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATEL
YCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLD
LEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAI
CTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRND
LNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCD
DCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRP
VHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGT
HVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKL
IVNMKSFVQHWKPSLGRKVMDILKRECK
Download sequence
Identical sequences Q9HB63
NP_067052.2.87134 NP_067052.2.92137 ENSP00000340998 NYSGRC-93204871 9606.ENSP00000340998 gi|93204871|ref|NP_067052.2| ENSP00000340998 ENSP00000340998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]