SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94721248|ref|NP_001035535.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94721248|ref|NP_001035535.1|
Domain Number 1 Region: 29-271
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-35
Family Ankyrin repeat 0.0005
Further Details:      
 
Domain Number 2 Region: 288-333
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94721248|ref|NP_001035535.1|
Sequence length 335
Comment ankyrin repeat and SOCS box protein 1 [Homo sapiens]
Sequence
MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE
SYRSRINEKSVWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVV
NGHLESTQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDV
QPRFSRRLTSLVVCPLYISAAYHNLQCFRLLLLAGANPDFNCNGPVNTQGFYRGSPGCVM
DAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLL
CLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE
Download sequence
Identical sequences H2QJQ2 Q9Y576
gi|94721248|ref|NP_001035535.1| ENSP00000264607 ENSP00000264607 9598.ENSPTRP00000022408 9606.ENSP00000264607 ENSP00000264607 ENSPTRP00000022408 ENSPTRP00000022408 NP_001035535.1.87134 NP_001035535.1.92137 XP_003813137.1.60992 XP_516189.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]