SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94721336|ref|NP_079434.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94721336|ref|NP_079434.3|
Domain Number 1 Region: 109-275
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-51
Family RUN domain 0.000000233
Further Details:      
 
Domain Number 2 Region: 594-704
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|94721336|ref|NP_079434.3|
Domain Number - Region: 300-363
Classification Level Classification E-value
Superfamily Prefoldin 0.0034
Family Prefoldin 0.0099
Further Details:      
 
Domain Number - Region: 451-635
Classification Level Classification E-value
Superfamily Tropomyosin 0.0301
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94721336|ref|NP_079434.3|
Sequence length 708
Comment RUN and FYVE domain-containing protein 1 isoform a [Homo sapiens]
Sequence
MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAE
GWSAPILTLARRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMM
KLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELV
EKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEP
EALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHER
ITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQL
REQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQK
NEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQL
HEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQ
KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRR
KHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Download sequence
Identical sequences Q96T51
gi|94721336|ref|NP_079434.3| 9606.ENSP00000377094 ENSP00000325594 ENSP00000325594 ENSP00000325594 NP_079434.3.87134 NP_079434.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]