SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|9558733|ref|NP_037425.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9558733|ref|NP_037425.1|
Domain Number 1 Region: 112-229
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-34
Family Canonical RBD 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|9558733|ref|NP_037425.1|
Sequence length 282
Comment transformer-2 protein homolog alpha [Homo sapiens]
Sequence
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
Download sequence
Identical sequences A0A2K5IG88 A0A2K5NHU8 A0A2K5PKW1 A0A2K5VE93 A0A2K5YK21 A0A2K6DGK7 A0A2K6UFD1 A9L927 G1RXL3 G3R105 G5BHC5 H0VHK3 H2PMN0 H2QU97 H9H310 I3MIH8 Q13595 Q549U1 U3F2N0
ENSP00000297071 ENSMMUP00000006174 gi|9558733|ref|NP_037425.1| ENSPPYP00000019871 ENSP00000297071 ENSGGOP00000008853 ENSGGOP00000019637 ENSNLEP00000017990 ENSNLEP00000017990 ENSPTRP00000032448 ENSP00000297071 ENSPANP00000005847 ENSGGOP00000008853 ENSMMUP00000006174 ENSPPYP00000019871 HGL_H00000297071 ENSPTRP00000032448 NP_001245042.1.72884 NP_037425.1.87134 NP_037425.1.92137 XP_001158245.1.37143 XP_002818189.1.23681 XP_003270451.1.23891 XP_003467980.2.53824 XP_004839611.1.39548 XP_005319166.1.77405 XP_005377457.1.28644 XP_005595599.1.63531 XP_008564753.1.73410 XP_010343975.1.74449 XP_011729465.1.29376 XP_011799587.1.43180 XP_011829328.1.47321 XP_011936727.1.92194 XP_012659834.1.62490 XP_015345611.1.40921 XP_016801027.1.37143 XP_017382477.1.71028 XP_017830744.1.60252 XP_018886964.1.27298 9544.ENSMMUP00000006174 9598.ENSPTRP00000032448 9600.ENSPPYP00000019871 9606.ENSP00000297071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]