SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|96975023|ref|NP_874362.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|96975023|ref|NP_874362.3|
Domain Number 1 Region: 19-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.69e-80
Family Ankyrin repeat 0.00000951
Further Details:      
 
Domain Number 2 Region: 405-495
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-17
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|96975023|ref|NP_874362.3|
Sequence length 522
Comment ankyrin repeat and death domain-containing protein 1A [Homo sapiens]
Sequence
MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGH
EQAVRLLLEHEAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCE
SKDGLTLLHCAAQKGHVPVLAFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVG
SGCDHNVKDKEGNTALHLAAGRGHMAVLQRLVDIGLDLEEQNAEGLTALHSAAGGSHPDC
VQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVR
HNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDLNLRDKQGKTA
LAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKA
LFEGLVAIGRRDLAGWSTMARSQLTATSASRVQMILVPQPPE
Download sequence
Identical sequences Q495B1
ENSP00000325895 ENSP00000325895 9606.ENSP00000369579 ENSP00000369579 gi|96975023|ref|NP_874362.3| NP_874362.3.87134 NP_874362.3.92137 HR6001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]