SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|9910348|ref|NP_064514.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9910348|ref|NP_064514.1|
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.05e-42
Family Galectin (animal S-lectin) 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|9910348|ref|NP_064514.1|
Sequence length 139
Comment placental protein 13-like isoform 1 [Homo sapiens]
Sequence
MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGH
PAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPAS
VKMLQVFRDISLTRVLISD
Download sequence
Identical sequences Q8TCE9
NP_064514.1.87134 NP_064514.1.92137 NYSGRC-LECT-ENSP00000375905 ENSP00000375905 gi|9910348|ref|NP_064514.1| ENSP00000375905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]