SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|9966913|ref|NP_065178.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9966913|ref|NP_065178.1|
Domain Number 1 Region: 162-414
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.21e-81
Family Actin/HSP70 0.000000000626
Further Details:      
 
Domain Number 2 Region: 4-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.9e-50
Family Actin/HSP70 0.0000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|9966913|ref|NP_065178.1|
Sequence length 418
Comment actin-related protein 3B isoform 1 [Homo sapiens]
Sequence
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
Download sequence
Identical sequences A0A096MV78 A0A0D9R2J9 A0A2K5JU16 A0A2K5NZ59 A0A2K5PKE6 A0A2K6C557 A0A2K6RSM7 F7GSR6 F7H2T8 H2PP45 H2QVN4 Q9P1U1
gi|9966913|ref|NP_065178.1| ENSPPYP00000020413 ENSP00000256001 ENSPANP00000003753 ENSP00000256001 9544.ENSMMUP00000034516 9598.ENSPTRP00000034079 9600.ENSPPYP00000020413 9606.ENSP00000256001 ENSMMUP00000024893 ENSPPYP00000020413 ENSP00000256001 ENSCJAP00000036506 ENSPTRP00000034079 ENSCJAP00000036506 ENSPTRP00000034079 ENSMMUP00000034516 NP_001253118.1.72884 NP_065178.1.87134 NP_065178.1.92137 XP_001144350.1.37143 XP_002751859.1.60252 XP_002818749.1.23681 XP_005551289.1.63531 XP_007981754.1.81039 XP_010382361.1.97406 XP_011728179.1.29376 XP_011796914.1.43180 XP_011913189.1.92194 XP_017375293.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]