SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|9994201|ref|NP_062555.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9994201|ref|NP_062555.1|
Domain Number 1 Region: 294-623
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.62e-75
Family Pancreatic carboxypeptidases 0.00000185
Further Details:      
 
Domain Number 2 Region: 115-277
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.88e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00062
Further Details:      
 
Domain Number 3 Region: 624-721
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.73e-17
Family Carboxypeptidase regulatory domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|9994201|ref|NP_062555.1|
Sequence length 734
Comment probable carboxypeptidase X1 isoform 1 precursor [Homo sapiens]
Sequence
MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTS
EQHVRIRVIKKKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGL
ESLRVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGH
PTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVL
NLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHH
NYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMH
GNEALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVG
WAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETR
AVIKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSN
LAMQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHE
NELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDY
WRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPP
DLRRRLERLRGQKD
Download sequence
Identical sequences Q96SM3
NP_062555.1.87134 NP_062555.1.92137 ENSP00000369979 ENSP00000369979 ENSP00000369979 gi|9994201|ref|NP_062555.1| 9606.ENSP00000369979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]