SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110347439|ref|NP_037494.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110347439|ref|NP_037494.2|
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 521-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 632-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000106
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 151-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000461
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 371-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000838
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 231-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000087
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110347439|ref|NP_037494.2|
Sequence length 706
Comment zinc finger protein 225 [Homo sapiens]
Sequence
MTTLKEAVTFKDVAVVFTEEELRLLDLAQRKLYREVMLENFRNLLSVGHQSLHRDTFHFL
KEEKFWMMETATQREGNLGGKIQMEMETVSESGTHEGLFSHQTWEQISSDLTRFQDSMVN
SFQFSKQDDMPCQVDAGLSIIHVRQKPSEGRTCKKSFSDVSVLDLHQQLQSREKSHTCDE
CGKSFCYSSALRIHQRVHMGEKLYNCDVCGKEFNQSSHLQIHQRIHTGEKPFKCEQCGKG
FSRRSGLYVHRKLHTGVKPHICEKCGKAFIHDSQLQEHQRIHTGEKPFKCDICCKSFRSR
ANLNRHSMVHMREKPFRCDTCGKSFGLKSALNSHRMVHTGEKRYKCEECGKRFIYRQDLY
KHQIDHTGEKPYNCKECGKSFRWASGLSRHVRVHSGETTFKCEECGKGFYTNSQRYSHQR
AHSGEKPYRCEECGKGYKRRLDLDFHQRVHRGEKPYNCKECGKSFGWASCLLNHQRIHSG
EKPFKCEECGKRFTQNSQLYTHRRVHSGEKPFKCEECGKRFTQNSQLYSHRRVHTGVKPY
KCEECGKGFNSKFNLDMHQRVHTGERPYNCKECGKSFSRASSILNHKRLHGDEKPFKCEE
CGKRFTENSQLHSHQRVHTGEKPYKCEKCGKSFRWASTHLTHQRLHSREKLLQCEDCGKS
IVHSSCLKDQQRDQSGEKTSKCEDCGKRYKRRLNLDTLLSLFLNDT
Download sequence
Identical sequences Q9UK10
ENSP00000262894 ENSP00000468686 ENSP00000262894 NP_001308614.1.87134 NP_001308614.1.92137 NP_037494.2.87134 NP_037494.2.92137 XP_011525587.1.92137 XP_011525588.1.92137 ENSP00000262894 ENSP00000468686 9606.ENSP00000262894 gi|110347439|ref|NP_037494.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]