SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115511044|ref|NP_001070146.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115511044|ref|NP_001070146.1|
Domain Number 1 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 11-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 609-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.56e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 665-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-21
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 218-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.75e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 711-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-18
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-17
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 12 Region: 163-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000455
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115511044|ref|NP_001070146.1|
Sequence length 774
Comment zinc finger protein 493 isoform 3 [Homo sapiens]
Sequence
MPGPPESLDMGPLTFRDVAIEFSLEEWQCLDTAQQDLYRKVMLENYRNLVFLGIAVSKPD
LVTCLEQGKDPWNMKGHSTVVKPPVICSHFAEDFCPGPGIKDSFQKVILREYVKCGHKDL
QLRKGCKSMNECNVHKEGYNELNQYLTTTQSKIFQCDKYVKVFHKLLNSNRHNTKHTGKK
PFKCKKCGKSFCMLLHLCQHKRIHIRENSYRCEECGKAFIWFSTLTRHRRVHTGEKSYKY
ECGKSFNQDSNLTTHKRIHTGQKPYKCEECGTSFYQFSYLTRHKLIHTREKPYKCEQYGK
TFNQSSTLTGHKIIHNGEKPYKCEECGKAFSIFSTPTKHKIIHTEEKSHRCEEYCKAYKE
SSHLTTHKRIHTGEKPYKCEECGKAFSIFSTLTKHKIIHTEEKSHRCEECGKAYKESSHL
TTHKRIHTGEKPYKCEECGKTFSVFSILTKHKIIHTEEKPYKCEECGKAFKRSSTLTKHR
IIHTEEKPYKCEECGKAFNQSSTLSIHKIIHTGEKPYKCEECGKAFKRSSTLTIHKMIHT
GEKPYKCEECGKAFNRSSHLTTHKRIHTGHKPYKCKECGKSFSVFSTLTKHKIIHTDKKP
YKCEECGKAFNRSSILSIHKKIHTGEKPYKCEECGKAFKRSSHLAGHKQIHSVQKPYKCE
ECGKAFSIFSTLTKHKIIHTEEKPYKCEKCGKTFYRFSNLNTHKIIHTGEKPCKCEECGK
AFNHSSNLIKHKLIHTGDKPYKCEACGKAFRRSSHLSRHKIIHIGIHTEETVQK
Download sequence
Identical sequences ENSP00000340651 9606.ENSP00000376110 NP_001070146.1.87134 NP_001070146.1.92137 gi|115511044|ref|NP_001070146.1| ENSP00000376110 ENSP00000376110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]