SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116517330|ref|NP_001004311.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116517330|ref|NP_001004311.2|
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116517330|ref|NP_001004311.2|
Sequence length 219
Comment factor in the germline alpha [Homo sapiens]
Sequence
MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSG
EPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV
Download sequence
Identical sequences Q6QHK4
ENSP00000333097 NP_001004311.2.87134 NP_001004311.2.92137 9606.ENSP00000333097 ENSP00000333097 gi|116517330|ref|NP_001004311.2| ENSP00000333097 ENSP00000475436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]