SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118600985|ref|NP_003421.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118600985|ref|NP_003421.2|
Domain Number 1 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.58e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 778-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 1002-1059
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 722-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 946-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 1058-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 890-947
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-24
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-24
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 11 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 13 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 14 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 15 Region: 1100-1152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 16 Region: 834-891
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 17 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 18 Region: 377-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000556
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 19 Region: 163-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000746
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 20 Region: 517-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000973
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118600985|ref|NP_003421.2|
Sequence length 1191
Comment zinc finger protein 91 [Homo sapiens]
Sequence
MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPD
LITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENL
QLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKK
CFKCKKCVKSFCIRLHKTQHKCVYITEKSCKCKECEKTFHWSSTLTNHKEIHTEDKPYKC
EECGKAFKQLSTLTTHKIICAKEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECG
KAFSHSSTLAKHKRIHTGEKPYKCEECGKAFSRSSTLAKHKRIHTGEKPYKCKECGKAFS
NSSTLANHKITHTEEKPYKCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSN
LTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRH
KRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIH
SREKPYKCKECGKAFKQFSTLTTHKIIHAGKKLYKCEECGKAFNHSSSLSTHKIIHTGEK
SYKCEECGKAFLWSSTLRRHKRIHTGEKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKC
KECGKAFSNSSTLANHKITHTEEKPYKCKECDKTFKRLSTLTKHKIIHAGEKLYKCEECG
KAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFI
WSSTLTRHKRIHTGEKPYKCEECGKAFSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSA
LAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEH
KRIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIH
TGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHTRMHTGEK
PYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECGKAFISSSTLNGHKRIHTREKPYKC
EECGKAFSQSSTLTRHKRLHTGEKPYKCGECGKAFKESSALTKHKIIHTGEKPYKCEKCG
KAFNQSSILTNHKKIHTITPVIPLLWEAEAGGSRGQEMETILANTVKPLLY
Download sequence
Identical sequences Q05481
NP_003421.2.87134 NP_003421.2.92137 9606.ENSP00000300619 ENSP00000300619 ENSP00000300619 ENSP00000300619 gi|118600985|ref|NP_003421.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]