SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|122937213|ref|NP_001073878.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122937213|ref|NP_001073878.1|
Domain Number 1 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 868-925
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-23
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 7 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 782-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.49e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 21-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 11 Region: 678-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 13 Region: 924-979
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 14 Region: 732-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 15 Region: 979-1031
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 16 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000546
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 17 Region: 830-861
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000196
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 18 Region: 417-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000155
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|122937213|ref|NP_001073878.1|
Sequence length 1036
Comment zinc finger protein 99 [Homo sapiens]
Sequence
MSFWSEKCTRLILYDLKIALKNGSLTFWDVTIEFALEEWQCLDMAQQNLYRNVMLENYRN
LVFLGIAVSKLDLITCLKQGKEPWNMKRHEMVTKPPVISSHFTQDFWPDQSIKDSFQEII
LRTYARCGHKNLRLRKDCESVNEGKMHEEAYNKLNQCWTTTQGKIFQCNKYVKVFHKYSN
SNRYKIIHTGKKPYKCEECGKAFKQSSHLTRHKAIHTGEKPYKCEECGKAFNHFSALRKH
QIIHTGKKPYKCEECGKAFSQSSTLRKHEIIHTEEKPYKYEECGKAFSNLSALRKHEIIH
TGQKPYKCEECGKAFKWSSKLTVHKVIHTAEKPCKCEECGKAFKRFSALRKHKIIHTGKQ
PYKCEECSKAFSNFSALRKHEIIHTGEKPYKCEECGKAFKWSSKLTVHKVIHMEEKPCKC
EECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGKKPYKCEECG
KAFKQSSHLTRHKAIHTGEKPYKCEECGKAFNHFSALRKHQIIHTGKKPYKCEECGKAFS
QSSTLRKHEIIHTGEKPYKCEECGKAFKWSSHLTRHKVIHTEEKPYKCEECGKAFNHFSA
LRKHKIIHTGKKPYKCEECGKAFSQSSTLRKHEIIHTGEKPYKCEECGKAFKWSSKLTVH
KVIHTAEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLRKHEIIH
TGEKSYKCEECALRKHEIIHTGKKPYKCEECGKAFNNSSTLRKHKIIYTGKKPYKCEECG
KAFKQSSHLTRHKAVHTGEKPYKCGECGKAFNNSSTLKKHKLIHTREKSYKCEECGKAFS
NFSALRKHKIIHTGEKPYKCEECECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKGFNNF
STLMKHKIIHTGEKPYKCEECGKAFKQSSHLTKHKSIHTGEKPYKCEERGKAFSHFSRLT
KHRIIHTGKKPYKCEECEKPYKCEECGKAFNQSSHLTQHKTIHTGGKTYKCEECGKAFNH
LSALTKHKIIHTGEKP
Download sequence
Identical sequences gi|122937213|ref|NP_001073878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]