SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126091152|ref|NP_001072.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126091152|ref|NP_001072.2|
Domain Number 1 Region: 932-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1390-1506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 3154-3279
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-35
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 4 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-35
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 5 Region: 2688-2799
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-34
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 6 Region: 2227-2334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-34
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 1169-1277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 8 Region: 1738-1848
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 9 Region: 1625-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-33
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 10 Region: 3036-3148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 11 Region: 3401-3506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-32
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 12 Region: 1053-1158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-31
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 13 Region: 1509-1617
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 14 Region: 2451-2564
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 15 Region: 3510-3621
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 16 Region: 2335-2447
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-30
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 17 Region: 1857-1964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-29
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 18 Region: 1990-2089
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-29
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 19 Region: 1278-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 20 Region: 824-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 21 Region: 2091-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-27
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 22 Region: 2570-2686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 23 Region: 2915-3037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-25
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 24 Region: 469-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-25
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 25 Region: 708-815
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 26 Region: 2804-2917
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 27 Region: 3285-3395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-18
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 28 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000214
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 29 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000219
Family EGF-type module 0.007
Further Details:      
 
Domain Number 30 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family EGF-type module 0.019
Further Details:      
 
Domain Number 31 Region: 130-267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000675
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 32 Region: 302-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000036
Family EGF-type module 0.016
Further Details:      
 
Domain Number 33 Region: 266-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000444
Family EGF-type module 0.019
Further Details:      
 
Domain Number 34 Region: 353-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000525
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126091152|ref|NP_001072.2|
Sequence length 3623
Comment cubilin precursor [Homo sapiens]
Sequence
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE
PKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC
DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEY
HSRCNFDVLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFN
ASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQ
DSCIMAYDGLSSTMSRLARTCGREQLANPIVSSGNSLFLRFQSGPSRQNRGFRAQFRQAC
GGHILTSSFDTVSSPRFPANYPNNQNCSWIIQAQPPLNHITLSFTHFELERSTTCARDFV
EILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGG
TFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDCSRDFVEIRE
GNATGHLVGRYCGNSFPLNYSSIVGHTLWVRFISDGSGSGTGFQATFMKIFGNDNIVGTH
GKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDIEEIQNCYYDKLRIYDGPSIHA
RLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAPDGVLPTIAPGACGG
FLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDSTVELNILSLDIESHRTCAYDSLVIR
DGDNNLAQQLAVLCGREIPGPIRSTGEYMFIRFTSDSSVTRAGFNASFHKSCGGYLHADR
GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPD
ICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEGQGFKIKYEAKSLACGGN
VYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYL
ELRDGVDSDAPILSKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRV
PGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDN
HTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSI
GTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNS
PQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSLPNTPEG
NFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQDCQFDVLEFRVGDA
DGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVI
TSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPII
GQYCGNSNPRTIQSGSNQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSDNGTIRSPH
WPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLA
TGCGNVAPGPVITPSNTFTAVFQSQEAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQY
DNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCG
DEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSGIITSPAYSYADYPN
DMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPN
VKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGMYD
KNLNCVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGST
VPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISSPNSSDPD
VPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASA
VPVFYSSMSTAMVIFKSGVVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKD
CTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFS
QNNELYLRFKSDSVTSDRGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWV
LVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSN
QVFIKFHADYARRPSAFRLTWDS
Download sequence
Identical sequences O60494
NP_001072.2.87134 NP_001072.2.92137 gi|126091152|ref|NP_001072.2| ENSP00000367064 ENSP00000367064 9606.ENSP00000367064 ENSP00000367054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]