SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13376331|ref|NP_079160.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13376331|ref|NP_079160.1|
Domain Number 1 Region: 49-276,307-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-41
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|13376331|ref|NP_079160.1|
Sequence length 463
Comment L-2-hydroxyglutarate dehydrogenase, mitochondrial precursor [Homo sapiens]
Sequence
MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCR
GLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPI
VIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKL
ASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV
FDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Download sequence
Identical sequences Q9H9P8
ENSP00000267436 ENSP00000405559 9606.ENSP00000267436 gi|13376331|ref|NP_079160.1| ENSP00000267436 ENSP00000405559 HR6632 NP_079160.1.87134 NP_079160.1.92137 XP_005268132.1.92137 ENSP00000267436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]