SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|13376886|ref|NP_079543.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|13376886|ref|NP_079543.1|
Domain Number 1 Region: 211-355
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.7e-31
Family AlaX-like 0.02
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.3e-22
Family Co-chaperone p23-like 0.00019
Further Details:      
 
Domain Number 3 Region: 152-208
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000261
Family AlaX-M N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|13376886|ref|NP_079543.1|
Sequence length 525
Comment alanyl-tRNA editing protein Aarsd1 isoform 2 [Homo sapiens]
Sequence
MEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCFV
RKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPP
AMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTINDI
SVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLKT
TSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGRG
LPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLSGNRVL
KWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRNS
PDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGP
RVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Download sequence
Identical sequences ENSP00000353355 gi|13376886|ref|NP_079543.1| NP_079543.1.87134 NP_079543.1.92137 ENSP00000353355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]