SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146198876|ref|NP_001018855.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146198876|ref|NP_001018855.2|
Domain Number 1 Region: 593-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 335-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-21
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.26e-18
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 408-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-18
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 297-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 233-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000235
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 679-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000332
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 720-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000029
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 201-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000501
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  gi|146198876|ref|NP_001018855.2|
Domain Number - Region: 133-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000277
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146198876|ref|NP_001018855.2|
Sequence length 778
Comment zinc finger protein 749 [Homo sapiens]
Sequence
MNLTEDCMVFEDVAIYFSQEEWGILNDAQRHLHSNVMLENFALLSSVGCWHGAKDEEVPS
KQCVSVRVLQVTIPKPALSTLKAQPCKMCSSILKDILHLAEHDGTHPEQGLYTCAAEHDL
HQKEQIREKLTRSDEWRPSFVNHSAHVGERNFTCTQGGKDFTASSDLLQQQVLNSGWKLY
RDTQDGEAFQGEQNDFNSSQGGKDFCHQHGLFEHQKTHNGERPYEFSECGELFRYNSNLI
KYQQNHAGERPYEGTEYGKTFIRKSNLVQHQKIHSEGFLSKRSDPIEHQEILSRPTPYEC
TQCGKAFLTQAHLVGHQKTHTGEQPYECNKCGKFFMYNSKLIRHQKVHTGERRYECSECG
KLFMDSFTLGRHQRVHTGERPFECSICGKFFSHRSTLNMHQRVHAGKRLYKCSECGKAFS
LKHNVVQHLKIHTGERPYECTECEKAFVRKSHLVQHQKIHTDAFSKRSDLIQHKRIDIRP
RPYTCSECGKAFLTQAHLVGHQKIHTGERPYECTQCAKAFVRKSHLVQHEKIHTDAFSKR
SDLIQHKRIDLRPRPYVCSECGKAFLTQAHLDGHQKIQTGERRYECNECGKFFLDSYKLV
IHQRIHTGEKPYKCSKCGKFFRYRCTLSRHQKVHTGERPYECSECGKFFRDSYKLIIHQR
VHTGEKPYECSNCGKFLRYRSTFIKHHKVCTGEKPHECSKCRELFRTKSSLIIHQQSHTG
ESPFKLRECGKDFNKCNTGQRQKTHTGERSYECGESSKVFKYNSSLIKHQIIHTGKRP
Download sequence
Identical sequences O43361
ENSP00000333980 gi|146198876|ref|NP_001018855.2| ENSP00000333980 9606.ENSP00000333980 NP_001018855.2.87134 NP_001018855.2.92137 XP_016882291.1.92137 ENSP00000333980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]