SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148727278|ref|NP_001013681.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148727278|ref|NP_001013681.2|
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 225-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|148727278|ref|NP_001013681.2|
Domain Number - Region: 173-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000299
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148727278|ref|NP_001013681.2|
Sequence length 406
Comment zinc finger protein 793 [Homo sapiens]
Sequence
MIEYQIPVSFKDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLVSVGYEGTKPDVILRL
EQEEAPWIGEAACPGCHCWEDIWRVNIQRKRRQDMLLRPGAAISKKTLPKEKSCEYNKFG
KISLLSTDLFSSIQSPSNWNPCGKNLNHNLDLIGFKRNCAKKQDECYAYGKLLQRINHGR
RPNGEKPRGCSHCEKAFTQNPALMYKPAVSDSLLYKRKRVPPTEKPHVCSECGKAFCYKS
EFIRHQRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFFCGKAFTQKSHRTE
HQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGERPYRCRECGKSFSQKSCLNKHWRT
HTGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT
Download sequence
Identical sequences Q6ZN11
gi|148727278|ref|NP_001013681.2| ENSP00000396402 ENSP00000468605 ENSP00000396402 ENSP00000444355 ENSP00000468605 9606.ENSP00000396402 NP_001013681.2.87134 NP_001013681.2.92137 XP_005258984.1.92137 XP_006723276.1.92137 ENSP00000396402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]