SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|149274621|ref|NP_001092272.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149274621|ref|NP_001092272.1|
Domain Number 1 Region: 106-332
Classification Level Classification E-value
Superfamily RNI-like 2.47e-34
Family 28-residue LRR 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|149274621|ref|NP_001092272.1|
Domain Number - Region: 437-495
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0012
Family Coiled-coil dimerization domain from cortexillin I 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|149274621|ref|NP_001092272.1|
Sequence length 722
Comment centrosomal protein of 78 kDa isoform a [Homo sapiens]
Sequence
MIDSVKLRRDSAADFFSHYEYLCALQNSVPLPAVRACLREGVLDFNADRLRGVDWAPLLS
TLKINKDLPLVSIKSFFQPWLGDTGSDMNKFCRSRVPAIRYKDVTFQLCKALKGCLSISS
VLKNLELNGLILRERDLTILAKGLNKSASLVHLSLANCPIGDGGLEIICQGIKSSITLKT
VNFTGCNLTWQGADHMAKILKYQTMRRHEETWAESLRYRRPDLDCMAGLRRITLNCNTLI
GDLGACAFADSLSEDLWLRALDLQQCGLTNEGAKALLEALETNTTLVVLDIRKNPLIDHS
MMKAVIKKVLQNGRSAKSEYQWITSPSVKEPSKTAKQKRRTIILGSGHKGKATIRIVGLA
TKKPVSSGRKHSLGKEYYAPAPLPPGVSGFLPWRTAERAKRHRGFPLIKTRDICNQLQQP
GFPVTVTVESPSSSEVEEVDDSSESVHEVPEKTSIEQEALQEKLEECLKQLKEERVIRLK
VDKRVSELEHENAQLRNINFSLSEALHAQSLTNMILDDEGVLGSIENSFQKFHAFLDLLK
DAGLGQLATMAGIDQSDFQLLGHPQMTSTVSNPPKEEKKALEDEKPEPKQNALGQMQNIQ
VSICMQSAYNEGTLMKFQKITGDARIPLPLDSFPVPVSTPEGLGTSSNNLGVPATEQRQE
SFEGFIARMCSPSPDATSGTGSQRKEEELSRNSRSSSEKKTKTGEYTKKHSDKQHPGKDL
HS
Download sequence
Identical sequences ENSP00000365783 NP_001092272.1.87134 NP_001092272.1.92137 NYSGRC-149274621 gi|149274621|ref|NP_001092272.1| ENSP00000365782 9606.ENSP00000365782 ENSP00000365782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]