SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153945736|ref|NP_853515.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153945736|ref|NP_853515.2|
Domain Number 1 Region: 316-394
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.17e-20
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 129-229
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000654
Family Myosin rod fragments 0.013
Further Details:      
 
Weak hits

Sequence:  gi|153945736|ref|NP_853515.2|
Domain Number - Region: 276-330
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0994
Family Intermediate filament protein, coiled coil region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153945736|ref|NP_853515.2|
Sequence length 459
Comment keratin, type I cytoskeletal 27 [Homo sapiens]
Sequence
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS
Download sequence
Identical sequences Q7Z3Y8
ENSP00000301656 NP_853515.2.87134 NP_853515.2.92137 ENSP00000301656 9606.ENSP00000301656 ENSP00000301656 gi|153945736|ref|NP_853515.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]