SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154354979|ref|NP_036466.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154354979|ref|NP_036466.2|
Domain Number 1 Region: 45-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-271
Family Motor proteins 0.000000000148
Further Details:      
 
Domain Number 2 Region: 1212-1308
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-27
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 3 Region: 1391-1510
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1794-1863,1906-1950
Classification Level Classification E-value
Superfamily Second domain of FERM 1.74e-17
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 5 Region: 1328-1383
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000215
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  gi|154354979|ref|NP_036466.2|
Domain Number - Region: 819-929,1214-1239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000565
Family BAR domain 0.04
Further Details:      
 
Domain Number - Region: 1701-1787
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0214
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1954-2040
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154354979|ref|NP_036466.2|
Sequence length 2058
Comment myosin-X [Homo sapiens]
Sequence
MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPT
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQ
YSRRHLGELPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSTPENYHYLNQSGCVEDKTI
SDQESFREVITAMDVMQFSKEEVREVSRLLAGILHLGNIEFITAGGAQVSFKTALGRSAE
LLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAVDSRDSLAMALYACCFEWVIKKINSR
IKGNEDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVA
VNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTL
KCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYS
GMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNLALPEDVRGKCTSLLQLYDASNSEWQLG
KTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNYRAFL
LRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEERERE
RERREAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDL
QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERS
LSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRT
SGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSGESTYCMPQNAG
DLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYNSSGAYRFSSEG
AQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLK
DETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLKGT
VEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIQEMH
DEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQ
RSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLG
TLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKA
PIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDK
GYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHP
GSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRN
MFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKD
SVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRL
KARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVSSA
RASIIDKWRKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAV
SVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMI
VKKRYSTTRSASSQGSSR
Download sequence
Identical sequences Q9HD67
gi|154354979|ref|NP_036466.2| ENSP00000421280 NP_036466.2.87134 NP_036466.2.92137 ENSP00000421280 ENSP00000274203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]