SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15618995|ref|NP_258259.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15618995|ref|NP_258259.1|
Domain Number 1 Region: 361-437
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.67e-21
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 129-163
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000277
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 170-239
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000251
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15618995|ref|NP_258259.1|
Sequence length 523
Comment keratin, type II cytoskeletal 71 [Homo sapiens]
Sequence
MSRQFTCKSGAAAKGGFSGCSAVLSGGSSSSFRAGSKGLSGGFGSRSLYSLGGVRSLNVA
SGSGKSGGYGFGRGRASGFAGSMFGSVALGPVCPTVCPPGGIHQVTVNESLLAPLNVELD
PEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPI
LEGYISNLRKQLETLSGDRVRLDSELRNVRDVVEDYKKRYEEEINKRTAAENEFVLLKKD
VDAAYANKVELQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSI
IDEVRTQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEISELTRLIQRIRS
EIENVKKQASNLETAIADAEQRGDNALKDARAKLDELEGALHQAKEELARMLREYQELMS
LKLALDMEIATYRKLLESEECRMSGEFPSPVSISIISSTSGGSVYGFRPSMVSGGYVANS
SNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
Download sequence
Identical sequences Q3SY84
ENSP00000267119 gi|15618995|ref|NP_258259.1| 9606.ENSP00000267119 ENSP00000267119 NP_258259.1.87134 NP_258259.1.92137 ENSP00000267119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]