SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157167158|ref|NP_001034975.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157167158|ref|NP_001034975.2|
Domain Number 1 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 799-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 603-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 715-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 841-893
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 10 Region: 659-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 17-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 12 Region: 215-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000628
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 762-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000218
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 14 Region: 370-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000581
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 15 Region: 510-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000466
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157167158|ref|NP_001034975.2|
Sequence length 903
Comment zinc finger protein 808 [Homo sapiens]
Sequence
MLREEAAQKRKGKESGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
EAVDISSKHMMKEVLSTGQGNREVIHTGTLQRHQSYHIGDFCFQEIEKEIHNIEFQCQED
ERNGHEAPTTKIKKLTGSTDQHDHRHAGNKPIKDQLGSSFYSHLPELHIFQIKGEIANQL
EKSTSDASSVSTSQRISCRPQIHISNNYGNNPLNSSLLPQKQEVHMREKSFPCNESGKAF
NCSSLLRKHQIPHLGDKQYKCDVCGKLFNHKQYLACHRRCHTGEKPYKCKECGKSFSYKS
SLTCHHRLHTGVKPYKCNECGKVFRQNSALVIHKAIHTGEKPYKCNECGKAFNQQSHLSR
HQRLHTGVKPYKCKICEKAFACHSYLANHTRIHSGEKTYKCNECGKAFNHQSSLARHHIL
HTGEKPYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLARHRRIHTGE
KTYKCNECRKTFSRRSSLLCHRRLHSGEKPYKCNQCGNTFRHRASLVYHRRLHTLEKSYK
CTVCNKVFMRNSVLAVHTRIHTAKKPYKCNECGKAFNQQSHLSRHRRLHTGEKPYKCEAC
DKVFGQKSALESHKRIHTGEKPYRCQVCDTAFTWNSQLARHTRIHTGEKTYKCNECGKTF
SYKSSLVWHRRLHGGEKSYKCKVCDKAFVCRSYVAKHTRIHSGMKPYKCNECSKTFSNRS
SLVCHRRIHSGEKPYKCSECSKTFSQKATLLCHRRLHSGEKPYKCNDCGNTFRHWSSLVY
HRRLHTGEKSYKCTVCDKAFVRNSYLARHIRIHTAEKPYKCNECGKAFNEQSHLSRHHRI
HTGEKPYKCEACDKVFSRKSHLKRHRIIHTGEKPYKCNECGKAFSDRSTLIHHQAIHGIG
KFD
Download sequence
Identical sequences Q8N4W9
NP_001034975.2.87134 NP_001034975.2.92137 NP_001308353.1.87134 NP_001308353.1.92137 NP_001308354.1.87134 NP_001308354.1.92137 ENSP00000352846 ENSP00000417727 9606.ENSP00000352846 ENSP00000352846 gi|157167158|ref|NP_001034975.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]