SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157739932|ref|NP_001099039.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157739932|ref|NP_001099039.1|
Domain Number 1 Region: 116-185
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157739932|ref|NP_001099039.1|
Sequence length 193
Comment mesogenin-1 [Homo sapiens]
Sequence
MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSP
CPAVAGLPCEHGGASSGGSEGCSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA
Download sequence
Identical sequences A6NI15
ENSP00000281047 gi|157739932|ref|NP_001099039.1| NP_001099039.1.87134 NP_001099039.1.92137 ENSP00000281047 ENSP00000281047 9606.ENSP00000281047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]