SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18677720|ref|NP_056441.6| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18677720|ref|NP_056441.6|
Domain Number 1 Region: 39-62,91-379
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-62
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 375-419
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000916
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18677720|ref|NP_056441.6|
Sequence length 421
Comment WD repeat and SOCS box-containing protein 1 isoform 1 [Homo sapiens]
Sequence
MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKL
VPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFL
WNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFS
TDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYR
I
Download sequence
Identical sequences A0A024QZ51 Q9Y6I7
gi|18677720|ref|NP_056441.6| NP_056441.6.87134 NP_056441.6.92137 ENSP00000262394 ENSP00000262394 ENSP00000262394 9606.ENSP00000262394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]