SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193083160|ref|NP_689568.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193083160|ref|NP_689568.2|
Domain Number 1 Region: 596-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 427-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-20
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 540-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 486-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 373-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 8 Region: 233-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 637-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000112
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 10 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000677
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 335-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000536
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 139-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000261
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193083160|ref|NP_689568.2|
Sequence length 693
Comment zinc finger protein 441 [Homo sapiens]
Sequence
MDSVAFEDVAINFTCEEWALLGPSQKSLYRDVMQETIRNLDCIGMIWQNHDIEEDQYKDL
RRNLRCHMVERACEIKDNSQCGGPFTQTQDSIVNEKIPGVDPWESSECTDVLMGRSSLNC
YVRVDSEHKPCEYQEYGEKPYTHTQCGTAFSYQPCFQIHERPQHGKKLYDCKECASFSSL
ENLQRHMAAHHGDGPRICKLCGNAFIWPSLFHMLRRTHTEEKPYEYEQCSTAFPAYSSTL
RHERTHSGEKPYQCKQCGKAFSCSCYTQLYERTHTGEQSYECKQCGKAFYHLGSFQRHMI
VHTGDGPHKCKICGKGFLSPSSVRRHKRTHTGEKPYECKYCGKAFSDCTGFRRHMITHTG
DGPHKCKVCGKAFDSPSLCRRHETTHTGEKPYKCECGKAFSDFYYFRNHETTHTGEKPYK
CKQCGKAFICCTYLQIHERIHTGERPYKCKQCGKAFRSSNYIRVHEKTHTGEKPYECKQC
GKALSHLKSFQRHMIMHTGDGPHKCKICGKSFDSPSSFRRHERIHTGERPYKCKLCGKGF
RSSSYIQLHERTHTGEKPYGCQQCGKALSDLSSFRRHMITHTGNGPHKCKICGKGFDYPS
SVQRHERTHTGEKPYECKECGKAFSHSSYLRIHERVHTGEKPYKCKECGKPFHCPSAFHK
HERTHSMEKPYKCKECGEAFHCISSFHKHEMTH
Download sequence
Identical sequences Q8N8Z8
ENSP00000350576 NP_689568.2.87134 NP_689568.2.92137 ENSP00000350576 gi|193083160|ref|NP_689568.2| 9606.ENSP00000350576 ENSP00000350576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]