SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197276654|ref|NP_002459.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197276654|ref|NP_002459.2|
Domain Number 1 Region: 173-307
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-28
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-135
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197276654|ref|NP_002459.2|
Sequence length 309
Comment myeloid differentiation primary response protein MyD88 isoform 2 [Homo sapiens]
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY
LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWT
RLAKALSLP
Download sequence
Identical sequences A0A0A0MS70
gi|197276654|ref|NP_002459.2| 9606.ENSP00000379625 ENSP00000379625 NP_002459.2.87134 NP_002459.2.92137 ENSP00000379625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]