SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|20143912|ref|NP_599027.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|20143912|ref|NP_599027.1|
Domain Number 1 Region: 14-233
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.41e-54
Family WD40-repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 229-273
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000484
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|20143912|ref|NP_599027.1|
Sequence length 275
Comment WD repeat and SOCS box-containing protein 1 isoform 2 [Homo sapiens]
Sequence
MASFPPRVNEKEIGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNM
MKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSP
DGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHV
ASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPS
LQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI
Download sequence
Identical sequences A0A024QZ36 A0A2J8TM69
ENSP00000327055 gi|20143912|ref|NP_599027.1| ENSP00000327055 NP_599027.1.87134 NP_599027.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]