SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|210147457|ref|NP_001129737.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|210147457|ref|NP_001129737.1|
Domain Number 1 Region: 412-480
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000366
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Weak hits

Sequence:  gi|210147457|ref|NP_001129737.1|
Domain Number - Region: 57-87
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000628
Family Intermediate filament protein, coiled coil region 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|210147457|ref|NP_001129737.1|
Sequence length 517
Comment intermediate filament family orphan 2 [Homo sapiens]
Sequence
MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGL
NVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPG
GGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQG
PGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTL
QEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDI
TAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDE
MKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHET
ESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGS
ADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS
Download sequence
Identical sequences A0A2I2YJY9 H2PY67 Q5TF58
ENSP00000387941 ENSP00000387941 ENSGGOP00000005429 ENSP00000387941 ENSGGOP00000005429 gi|210147457|ref|NP_001129737.1| NP_001129737.1.87134 NP_001129737.1.92137 XP_003307885.2.37143 XP_004024829.1.27298 9606.ENSP00000387941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]