SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|211057416|ref|NP_001129971.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|211057416|ref|NP_001129971.1|
Domain Number 1 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 745-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 801-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 843-895
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 13 Region: 242-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-16
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|211057416|ref|NP_001129971.1|
Sequence length 924
Comment zinc finger protein 841 [Homo sapiens]
Sequence
MALPQGSLTFRDVAVEFSQEEWKCLDPVQKALYRDVMLENYRNLGFLGLCLPDLNIISML
EQGKEPWTVVSQVKIARNPNCGECMKGVITGISPKCVIKELPPIQNSNTGEKFQAVMLEG
HESYDTENFYFREIRKNLQEVDFQWKDGEINYKEGPMTHKNNLTGQRVRHSQGDVENKHM
ENQLILRFQSGLGELQKFQTAEKIYGCNQIERTVNNCFLASPLQRIFPGVQTNISRKYGN
DFLQLSLPTQDEKTHIREKPYIGNECGKAFRVSSSLINHQMIHTTEKPYRCNESGKAFHR
GSLLTVHQIVHTRGKPYQCDVCGRIFRQNSDLVNHRRSHTGDKPYICNECGKSFSKSSHL
AVHQRIHTGEKPYKCNRCGKCFSQSSSLATHQTVHTGDKPYKCNECGKTFKRNSSLTAHH
IIHAGKKPYTCDVCGKVFYQNSQLVRHQIIHTGETPYKCNECGKVFFQRSRLAGHRRIHT
GEKPYKCNECGKVFSQHSHLAVHQRVHTGEKPYKCNECGKAFNWGSLLTVHQRIHTGEKP
YKCNVCGKVFNYGGYLSVHMRCHTGEKPLHCNKCGMVFTYYSCLARHQRMHTGEKPYKCN
VCGKVFIDSGNLSIHRRSHTGEKPFQCNECGKVFSYYSCLARHRKIHTGEKPYKCNDCGK
AYTQRSSLTKHLVIHTGENPYHCNEFGEAFIQSSKLARYHRNPTGEKPHKCSECGRTFSH
KTSLVYHQRRHTGEMPYKCIECGKVFNSTTTLARHRRIHTGEKPYKCNECGKVFRYRSGL
ARHWSIHTGEKPYKCNECGKAFRVRSILLNHQMMHTGEKPYKCNECGKAFIERSNLVYHQ
RNHTGEKPYKCMECGKAFGRRSCLTKHQRIHSSEKPYKCNECGKSYISRSGLTKHQIKHA
GENLTTKLNVERPLDVVLTSGIPK
Download sequence
Identical sequences ENSP00000374185 ENSP00000470746 gi|211057416|ref|NP_001129971.1| NP_001129971.1.87134 NP_001129971.1.92137 XP_016882145.1.92137 XP_016882146.1.92137 ENSP00000353060 9606.ENSP00000415453 ENSP00000374185 ENSP00000470746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]