SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|214830438|ref|NP_001135770.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|214830438|ref|NP_001135770.1|
Domain Number 1 Region: 303-352
Classification Level Classification E-value
Superfamily UBA-like 8.68e-18
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily RING/U-box 6.59e-17
Family ZZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|214830438|ref|NP_001135770.1|
Sequence length 356
Comment sequestosome-1 isoform 2 [Homo sapiens]
Sequence
MAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSV
CPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPG
NWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGK
RSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEE
QMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYP
HLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences K7BNR7
NP_001135770.1.87134 NP_001135770.1.92137 NP_001135771.1.87134 NP_001135771.1.92137 XP_008959642.1.60992 XP_014200665.1.60992 XP_016809936.1.37143 XP_016809937.1.37143 XP_016809938.1.37143 XP_016865499.1.92137 ENSP00000353944 gi|214830438|ref|NP_001135770.1| gi|214830451|ref|NP_001135771.1| ENSP00000353944 ENSP00000366128 ENSP00000385553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]