SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|215820635|ref|NP_001135974.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215820635|ref|NP_001135974.1|
Domain Number 1 Region: 630-750
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-24
Family Ankyrin repeat 0.0000109
Further Details:      
 
Domain Number 2 Region: 580-599,760-817
Classification Level Classification E-value
Superfamily SH3-domain 1.26e-17
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|215820635|ref|NP_001135974.1|
Sequence length 828
Comment relA-associated inhibitor [Homo sapiens]
Sequence
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
Download sequence
Identical sequences A0A024R0Q5 Q8WUF5
ENSP00000354218 ENSP00000403902 ENSP00000354218 ENSP00000403902 ENSP00000354218 9606.ENSP00000354218 NP_001135974.1.87134 NP_001135974.1.92137 NP_006654.2.87134 NP_006654.2.92137 XP_016881666.1.92137 XP_016881667.1.92137 gi|215820635|ref|NP_001135974.1| gi|63003907|ref|NP_006654.2| HR4578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]