SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|216548627|ref|NP_001135939.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|216548627|ref|NP_001135939.1|
Domain Number 1 Region: 126-175
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000471
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 55-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000942
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|216548627|ref|NP_001135939.1|
Sequence length 247
Comment transcription factor HES-4 isoform 1 [Homo sapiens]
Sequence
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPD
PQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRV
QVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSR
RPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGG
PWRPWLR
Download sequence
Identical sequences E9PB28
ENSP00000393198 ENSP00000393198 ENSP00000304595 NP_001135939.1.87134 NP_001135939.1.92137 9606.ENSP00000393198 gi|216548627|ref|NP_001135939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]