SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|22027480|ref|NP_060012.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22027480|ref|NP_060012.3|
Domain Number 1 Region: 46-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-17
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 255-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000017
Family Centromere-binding 0.01
Further Details:      
 
Weak hits

Sequence:  gi|22027480|ref|NP_060012.3|
Domain Number - Region: 196-238
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0125
Family Cgl2762-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22027480|ref|NP_060012.3|
Sequence length 609
Comment pogo transposable element with KRAB domain [Homo sapiens]
Sequence
MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEE
WEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAE
NEESDVKPPDWPNPMNATSQFPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYD
LSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQ
LQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPE
KGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQM
GNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDS
VKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAK
KPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDC
DTESMAESN
Download sequence
Identical sequences A0A024R8Y1 Q9P215
ENSP00000356849 ENSP00000356850 ENSP00000356849 ENSP00000356850 9606.ENSP00000356849 ENSP00000356850 NP_060012.3.87134 NP_060012.3.92137 XP_005245427.1.92137 XP_011508116.1.92137 XP_016857403.1.92137 gi|22027480|ref|NP_060012.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]